PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_40357_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9279.78 Da    PI: 11.0638
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_40357_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.37.6e-321059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdaeva+iifs++gklye++s
  Neem_40357_f_1 10 RIENATSRQVTFSKRRNGLLKKAHELSVLCDAEVALIIFSPRGKLYEFAS 59
                    8***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.987161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-42160IPR002100Transcription factor, MADS-box
CDDcd002653.27E-39360No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-32323IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-30362IPR002100Transcription factor, MADS-box
PfamPF003191.9E-281057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAHELSVLCD AEVALIIFSP RGKLYEFASS  60
RYGTKRNDPN LMSLQHVLSE V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A3e-19360259Myocyte-specific enhancer factor 2A
3mu6_B3e-19360259Myocyte-specific enhancer factor 2A
3mu6_C3e-19360259Myocyte-specific enhancer factor 2A
3mu6_D3e-19360259Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007134936.13e-37hypothetical protein PHAVU_010G088100g
RefseqXP_007134937.13e-37hypothetical protein PHAVU_010G088100g
SwissprotO646452e-35SOC1_ARATH; MADS-box protein SOC1
TrEMBLV7ARU43e-37V7ARU4_PHAVU; Uncharacterized protein
STRINGPOPTR_0014s07020.14e-36(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-36AGAMOUS-like 20